"action" : "pulsate" { })(LITHIUM.jQuery); ] { { "action" : "rerender" { { "action" : "rerender" { } }, } "event" : "deleteMessage", Preisvergleich von Hardware und Software sowie Downloads bei Heise Medien. Es ist mal wieder so weit: Die Callya-Flex-App von Vodafone funktioniert nicht - und das bereits seit einigen Tagen. "context" : "", "context" : "envParam:feedbackData", "actions" : [ "event" : "MessagesWidgetMessageEdit", { "context" : "envParam:quiltName,message", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ABs_7aFZnjRe_9D-cBr5Vtb0BETiljJDJVcxPh6vzTs. ] Then the update to iOS 13.5. { { } { ] "useSimpleView" : "false", "context" : "envParam:entity", }); "event" : "editProductMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2211598 .lia-rating-control-passive', '#form_7'); { { "event" : "MessagesWidgetCommentForm", "event" : "ProductAnswerComment", "context" : "", "disableLinks" : "false", { } } "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", } "kudosable" : "true", "disableLabelLinks" : "false", }, "context" : "envParam:quiltName", }, { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", "action" : "rerender" } }); } } } { ] }, }, ] }, "event" : "editProductMessage", { sessionStorage.setItem("is_scroll", option); "context" : "", $(document).ready(function(){ "entity" : "2211948", }, "context" : "lia-deleted-state", "context" : "", { } "showCountOnly" : "false", $(document).ready(function(){ "action" : "pulsate" "context" : "envParam:feedbackData", "actions" : [ "linkDisabled" : "false" "displayStyle" : "horizontal", { }, "event" : "MessagesWidgetEditAnswerForm", } "truncateBody" : "true", }); "actions" : [ } { } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "approveMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); ;(function($){ "actions" : [ "context" : "", "initiatorBinding" : true, "context" : "envParam:quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "removeThreadUserEmailSubscription", { } ] { } }, "context" : "envParam:quiltName", "kudosLinksDisabled" : "false", } { } { "actions" : [ }); "useTruncatedSubject" : "true", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { // Set start to true only if the first key in the sequence is pressed { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "componentId" : "forums.widget.message-view", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); ] "displayStyle" : "horizontal", ] count = 0; "context" : "envParam:selectedMessage", }, "selector" : "#kudosButtonV2_8", "context" : "envParam:quiltName", "context" : "envParam:quiltName", "disableLinks" : "false", }, LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:quiltName", })(LITHIUM.jQuery); // Pull in global jQuery reference watching = false; document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "disableLabelLinks" : "false", "actions" : [ ] "action" : "rerender" { "event" : "QuickReply", LITHIUM.Dialog.options['1398265'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; // Oops. "quiltName" : "ForumMessage", } }, "event" : "RevokeSolutionAction", ', 'ajax'); }, return false; "actions" : [ { "actions" : [ var keycodes = { } else { { }, "context" : "envParam:quiltName", ] "action" : "rerender" LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "context" : "", "actions" : [ "action" : "pulsate" "}); } "context" : "envParam:selectedMessage", ] LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_69b9c4719f2ef9","tooltipContentSelector":"#link_69b9c4719f2ef9_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_69b9c4719f2ef9_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "context" : "", { "}); { "event" : "ProductAnswerComment", { } "actions" : [ if (doChecks(pagerId, val)) "actions" : [ ] "initiatorDataMatcher" : "data-lia-message-uid" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ "actions" : [ "useCountToKudo" : "false", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "context" : "", ] }, }, "useSubjectIcons" : "true", "event" : "MessagesWidgetMessageEdit", } }, })(LITHIUM.jQuery); "event" : "MessagesWidgetCommentForm", } "eventActions" : [ { ] "action" : "rerender" { "context" : "", "entity" : "2207581", "context" : "", if (doChecks(pagerId, val)) }, LITHIUM.Dialog.options['1398265'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" { ;(function($) { "action" : "rerender" "truncateBody" : "true", { ] ] { "action" : "rerender" "context" : "", "action" : "rerender" { { { } ] { watching = false; ] LITHIUM.AjaxSupport.ComponentEvents.set({ "}); { } // Oops. } "selector" : "#kudosButtonV2_3", "disallowZeroCount" : "false", "action" : "rerender" "action" : "rerender" "action" : "rerender" } LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" "quiltName" : "ForumMessage", { LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ ] { "actions" : [ }); { "disableKudosForAnonUser" : "false", "}); ] } { ] "context" : "lia-deleted-state", "context" : "", "truncateBody" : "true", }, { "actions" : [ ', 'ajax'); { "actions" : [ "context" : "", "action" : "rerender" "context" : "", $(document).ready(function(){ "useSimpleView" : "false", "actions" : [ "action" : "rerender" } }, "actions" : [ } "eventActions" : [ }); } ] { { "actions" : [ "event" : "ProductMessageEdit", if (val.trim() == "") }, "action" : "rerender" { "actions" : [ } { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); }, "event" : "MessagesWidgetEditAnswerForm", } "event" : "MessagesWidgetEditCommentForm", } } }, } { ] function setWarning(pagerId) { "action" : "rerender" } "event" : "addMessageUserEmailSubscription", "}); "eventActions" : [ } } "context" : "envParam:selectedMessage", { "action" : "rerender" "action" : "rerender" { Bist du sicher, dass du fortfahren möchtest? } "actions" : [ "kudosable" : "true", }, "event" : "expandMessage", }); ] "event" : "AcceptSolutionAction", ] "event" : "MessagesWidgetCommentForm", ] } "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "action" : "rerender" "eventActions" : [ "accessibility" : false, ] "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "disableLinks" : "false", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "selector" : "#messageview_5", { { { lithadmin: [] ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "actions" : [ "selector" : "#kudosButtonV2_5", "context" : "", "action" : "rerender" "actions" : [ }, { { "useCountToKudo" : "false", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } }); { { "event" : "removeMessageUserEmailSubscription", "actions" : [ { ] "action" : "rerender" { { { } ] "action" : "rerender" ], "quiltName" : "ForumMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetAnswerForm", { } ] "event" : "MessagesWidgetCommentForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "selector" : "#kudosButtonV2_4", "action" : "rerender" "actions" : [ "actions" : [ { }, "context" : "", "event" : "MessagesWidgetEditAction", }); return; "action" : "pulsate" { } "actions" : [ "truncateBody" : "true", { })(LITHIUM.jQuery); } $(document).ready(function(){ ] "truncateBodyRetainsHtml" : "false", "componentId" : "forums.widget.message-view", { } "action" : "rerender" "action" : "rerender" "event" : "ProductMessageEdit", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] o.innerHTML = "Page must be an integer number. "actions" : [ { element.siblings('li').children('ul').slideUp(); "actions" : [ ;(function($) { { "action" : "rerender" }, "event" : "removeMessageUserEmailSubscription", "event" : "ProductAnswer", { ] "action" : "pulsate" "kudosLinksDisabled" : "false", LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, ] ] "action" : "rerender" } "parameters" : { }, return; if (isNaN(val) ) "action" : "rerender" ] { "quiltName" : "ForumMessage", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "event" : "expandMessage", } else { } { { "eventActions" : [ { } { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] ] if (val.trim() == "") "actions" : [ "context" : "", "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", event.stopPropagation(); } ] { } var keycodes = { Natürlich kann es mal zu Fehlern in einer App kommen. "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1501,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNClNXAFQFABgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVTBlZWBVdVUhRTAwYDSQFVAFBIVF5fCk8BVVdRClZRVARSCABAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); var resetMenu = function() { { })(LITHIUM.jQuery); "accessibility" : false, }, "componentId" : "kudos.widget.button", { { } "linkDisabled" : "false" ] }, "action" : "rerender" } LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); Stell Dir jetzt Deinen eigenen Prepaid-Tarif zusammen, individuell und zu jeder Zeit: mit der CallYa Flex-App für Deinen Wunsch-Tarif. { "displaySubject" : "true", { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ZFe_6YB6nIr1ik0ElvD23qDKs1yliBhcaMoZr3KUp0I. "event" : "RevokeSolutionAction", "actions" : [ }, { }, LITHIUM.Dialog.options['1054953877'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "action" : "addClassName" "actions" : [ { element.siblings('li').find('li').removeClass('active'); "initiatorBinding" : true, "actions" : [ "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xcnLUVnhO3QAkAcxsBHwEoXQTwLmeWTihz7Pm25etb0. LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "parameters" : { }); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "showCountOnly" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:feedbackData", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", { "actions" : [ { ] { "revokeMode" : "true", return false; "truncateBody" : "true", "actions" : [ "event" : "MessagesWidgetCommentForm", }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "expandMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NxbiNG-xkA6QF6mndpKTFh72CRcLOAb7nvBjkFFUFLg. }, "}); { { } { "context" : "", "event" : "expandMessage", } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, { } { "context" : "envParam:quiltName,product,contextId,contextUrl", } "actions" : [ "actions" : [ } { { { "actions" : [ "event" : "MessagesWidgetEditCommentForm", if ( neededkeys[count] == key ) { { }, "includeRepliesModerationState" : "false", "event" : "editProductMessage", var watching = false; "initiatorBinding" : true, }, "actions" : [ "event" : "MessagesWidgetEditAction", "}); setWarning(pagerId); "action" : "rerender" { Zumal das ja kein wirklich neues Problem ist, die App ging in der Vergangenheit ja auch regelmäßig nicht. } { "quiltName" : "ForumMessage", } ] Was funktioniert genau nicht, wann tritt der Fehler auf und wie äußert sich der Fehler/ Fehlermeldung? } }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ I have been an iPhone junkie since the inception of iPhone. { "event" : "addMessageUserEmailSubscription", "useSimpleView" : "false", return false; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"FYyAYPwtv8FLZGDOLY9jGawCCnLw7RhUBkYwItKIGNQ. }, }, ', 'ajax'); ] ] var key = e.keyCode; }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'N2LzjD_E9tM9H8S2dnNfRQ12oP5BrVGCVCt81IUAksg. { }, "actions" : [ { o.innerHTML = "Page number can\'t exceed 3. }, { "actions" : [ "; "context" : "envParam:feedbackData", ] } "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" Bist du sicher, dass du fortfahren möchtest?